Home >> Signaling Pathways

Signaling Pathways(信号通路)

  1. Cat.No. 产品名称 Information
  2. GC52391 306-O12B-3 An ionizable cationic lipidoid
  3. GC52390 Spexin 1 (human, mouse, rat, bovine) (acetate)

    Neuropeptide Q, NPQ, NWTPQAMLYLKGAQ-NH2, SPX1

    An endogenous peptide and agonist of GAL2 and GAL3
  4. GC52389 Caveolin-1 (82-101) amide (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Cav-1, Caveolin-1 Scaffolding Domain Peptide, CSD, CSP, DGIWKASFTTFTVTKYWFYR-NH2

    A synthetic peptide fragment of caveolin-1
  5. GC52388 [D-Lys3]-GHRP-6 (trifluoroacetate salt)

    D-Lys3-Growth Hormone Releasing Peptide 6, His-D-Trp-D-Lys-Trp-D-Phe-Lys-NH2

    An antagonist of GHS-R1a
  6. GC52387 Crosstide (trifluoroacetate salt)

    Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly-OH, GRPRTSSFAEG-OH

    A peptide substrate for Akt
  7. GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)

    EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist

    An MBP (85-99) antagonist
  8. GC52384 NFAT Inhibitor (cell-permeable) (trifluoroacetate salt)

    Nuclear Factor Activated T cells Inhibitor, RRRRRRRRRRRGGGMAGPHPVIVITGPHEE, 11R-VIVIT

    A cell-permeable form of NFAT inhibitor
  9. GC52382 Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

    NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2

    A peptide fragment of Nogo-A
  10. GC52380 AOD-9604 (acetate) A synthetic lipolytic peptide
  11. GC52378 Cecropin A (trifluoroacetate salt) An antimicrobial peptide
  12. GC52376 BMP2-derived Peptide (trifluoroacetate salt)

    Bone Morphogenic Protein 2-derived Peptide, KIPKASSVPTELSAISTLYL-NH2

    A synthetic peptide
  13. GC52372 Ac-VDVAD-AFC (trifluoroacetate salt)

    N-Acetyl-Val-Asp-Val-Ala-Asp-AFC, N-Acetyl-Val-Asp-Val-Ala-Asp-7-amino-4-Trifluoromethylcoumarin, Caspase-2 Substrate (Fluorogenic)

    A fluorogenic substrate for caspase-2
  14. GC52371 Vimentin (G146R) (139-159)-biotin Peptide

    Biotin-GQGKSRLRDLYEEEMRELRRQ, Biotin-GQGKSRLRDLYEEEMRELRRQ (X=Citrulline), VIM (G146R) (139-159)-biotin

    A biotinylated mutant vimentin peptide
  15. GC52370 Citrullinated Vimentin (R144) (139-159)-biotin Peptide

    Biotin-GQGKS(Cit)LGDLYEEEMRELRRQ, Biotin-GQGKSXLGDLYEEEMRELRRQ (X=Citrulline), Citrullinated VIM (R144)-biotin

    A biotinylated and citrullinated vimentin peptide
  16. GC52369 Cecropin B (trifluoroacetate salt) An antimicrobial peptide
  17. GC52368 DL-Sulforaphane Glutathione

    SFN-glutathione, SFN-GSH, Sulforaphane-GSH

    A metabolite of sulforaphane
  18. GC52367 Citrullinated Vimentin (G146R) (R144 + R146) (139-159)-biotin Peptide

    Biotin-GQGKS(Cit)L(Cit)DLYEEEMRELRRQ, Biotin-GQGKSXLXDLYEEEMRELRRQ (X=Citrulline), Citrullinated VIM (G146R) (R144 + R146)-biotin

    A biotinylated and citrullinated mutant vimentin peptide
  19. GC52365 4-tert-Octylphenol monoethoxylate

    NSC 5259, OP1EO

    An alkylphenolethoxylate and a degradation product of non-ionic surfactants
  20. GC52364 Vimentin (139-159)-biotin Peptide

    VIM (139-159)-biotin

    A biotinylated vimentin peptide
  21. GC52363 Citrullinated Histone H3 (R2 + R8 + R17) (2-22)-biotin Peptide

    Biotin-A-Cit-TKQTA-Cit-KSTGGKAP-Cit-KQLA, Biotin-AXTKQTAXKSTGGKAPXKQLA (X=Citrulline), Citrullinated Histone H3.1-biotin

    A biotinylated and citrullinated histone H3 peptide

  22. GC52362 ENPP3 Inhibitor 4g An ENPP1 and ENPP3 inhibitor
  23. GC52361 AMARA Peptide (trifluoroacetate salt)

    AMARAASAAALARRR-OH, H-Ala-Met-Ala-Arg-Ala-Ala-Ser-Ala-Ala-Ala-Leu-Ala-Arg-Arg-Arg-OH

    A peptide substrate for AMPK
  24. GC52360 Chymotrypsin Substrate I, Colorimetric (trifluoroacetate salt)

    Suc-GGF-pNA, Suc-Gly-Gly-Phe-pNA, Suc-Gly-Gly-Phe-p-Nitroanilide

    A colorimetric chymotrypsin substrate
  25. GC52359 ATX-100 An ionizable cationic lipid
  26. GC52358 Malachite Green (chloride)

    Basic Green 4, C.I. 4200, C.I. 42000

    A triphenylmethane dye
  27. GC52356 1-1(Z)-Hexadecenyl-2-Arachidonoyl-sn-glycero-3-PC

    1-1(Z)-Hexadecenyl-2-Arachidonoyl-sn-glycero-3-Phosphocholine, 1-1(Z)-Hexadecenyl-2-Arachidonoyl-sn-glycero-3-Phosphatidylcholine, 16:0p/20:4-PC, PC(P-16:0/20:4), C16(plasm)-20:4-PC, PlgPC 16:0/20:4

    A plasmalogen
  28. GC52355 BimS BH3 (51-76) (human) (trifluoroacetate salt)

    DMRPEIWIAQELRRIGDEFNAYYARR-OH, Bims (51-76)

    A Bim-derived peptide
  29. GC52354 Tertiapin Q (trifluoroacetate salt)

    TPN(M13Q), TPNQ

    A peptide derivative of tertiapin
  30. GC52351 Citrullinated α-Enolase (R8 + R14) (1-19)-biotin Peptide

    Citrullinated Enolase-1-biotin, α-Enolase Peptide (Citrulline Residues 8 + 14)

    A biotinylated and citrullinated α-enolase peptide
  31. GC52346 IDR 1002 (trifluoroacetate salt) A synthetic cationic innate defense regulator peptide
  32. GC52344 Bak BH3 (72-87) (human) (trifluoroacetate salt) A Bak-derived peptide
  33. GC52343 113-O12B An ionizable cationic lipidoid
  34. GC52342 P4pal10 (trifluoroacetate salt)

    Palmitoyl-SGRRYGHALR-amide, Palmitoyl-SGRRYGHALR-NH2

    A PAR4 and FPR2 antagonist and an FFAR2 agonist
  35. GC52339 CAY10793 A quinazolinone-containing compound
  36. GC52338 α-Conotoxin PnIA (trifluoroacetate salt)

    α-CtxPnIA, αPnIA

    A peptide antagonist of α3β2-subunit containing and α7 nAChRs
  37. GC52336 ENPP1 Inhibitor 43 An ENPP1 inhibitor
  38. GC52334 ENPP1 Inhibitor 4e

    cGAMP-compound 4e

    An ENPP1 inhibitor
  39. GC52333 DSPE-PEG(2000)-NHS

    A PEGylated derivative of DSPE

  40. GC52332 Arimoclomol

    BRX-220

    A co-inducer of heat shock proteins
  41. GC52331 Lactoyl Phenylalanine

    Lac-Phe, N-Lactoyl-Phenylalanine

    A secondary metabolite

  42. GC52329 Betamethasone-d5

    β-Methasone-d5, SCH 4831-d5

    An internal standard for the quantification of betamethasone
  43. GC52328 KYL (trifluoroacetate salt)

    KYL Peptide

    An EphA4 inhibitor
  44. GC52327 Ciraparantag (trifluoroacetate salt)

    PER977

    An anticoagulant reversal agent
  45. GC52326 Biotin-PEG4-LL-37 (human) (trifluoroacetate salt) A biotinylated and pegylated form of LL-37
  46. GC52325 MeTC7 A vitamin D receptor antagonist
  47. GC52324 3-(3-Hydroxyphenyl)propionic Acid sulfate

    3-HPPA sulfate

    A metabolite of certain phenols and glycosides
  48. GC52323 L-Isoleucine-13C6

    L-(+)-Isoleucine-13C6

    An internal standard for the quantification of L-isoleucine
  49. GC52322 ENPP3 Inhibitor 4t An ENPP3 inhibitor
  50. GC52321 ISP-I-28 An immunosuppressant
  51. GC52318 Oleic Acid-13C5

    9Z-Octadecenoic Acid-13C5, C18:1(9Z)-13C5, cis-9-Octadecenoic Acid-13C5

    An internal standard for the quantification of oleic acid

Items 6251 to 6300 of 10000 total

per page

Set Descending Direction