TGFB2 Human
目录号 : GP20949转化生长因子 Beta 2 人类重组
Sample solution is provided at 25 µL, 10mM.
| Purity | Greater than 97.0% as determined by SDS-PAGE. | Source | Nicotiana benthamiana. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Transforming growth factor; beta 2; cetermin; Glioblastoma-derived T-cell suppressor factor; polyergin; G-TSF; TGF-beta2; TGF-beta-2; transforming growth factor beta-2; BSC-1 cell growth inhibitor; TGFB-2. | ||
| Amino Acid Sequence | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS. | ||
| Solubility | It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1?g/40?l, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C . For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | ||
| Biological Activity | The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg. | ||
| Formulation | Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4. | ||
TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-ж┬ (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C . For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.















