LR3 IGF1 Human
目录号 : GP20416LR3 Insulin Like Growth Factor-1 Human Recombinant
Sample solution is provided at 25 µL, 10mM.
| Purity | Greater than 95.0% as determined by SDS-PAGE and HPLC. | Source | Escherichia Coli. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | R3 IGF1; R3 IGF-1; R3IGF1; R3IGF-1; LONG IGF1; LONG IGF-1; LONG R3 IGF1; LONG R3IGF1; LONG R3 IGF-1; LONG R3IGF-1. | ||
| Amino Acid Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA. | ||
| Solubility | It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. | ||
| Biological Activity | The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. | ||
| Formulation | Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS. | ||
IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.
Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.















