FGF 2 Human, HEK
目录号 : GP20213Fibroblast Growth Factor-basic Human Recombinant, HEK
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 95% as obsereved by SDS-PAGE. | Source | HEK. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Prostatropin; HBGH-2; HBGF-2; FGF-2; FGF-b. | ||
| Amino Acid Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYK. | ||
| Solubility | It is recommended to reconstitute the lyophilized FGF-b in sterile PBS containing 0.1% endotoxin-free recombinant HSA. | ||
| Stability | Lyophilized FGF-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution FGF-b should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. | ||
| Biological Activity | The specific activity was determined by the dose dependent stimulation of proliferation of the Balb/c 3T3 cell line, the ED50 is 0.03ng/ml. | ||
| Formulation | The FGF2 was filtered (0.2µm) and lyophilized from 1.26mg/ml in 1xPBS. | ||
Basic fibroblast growth factor is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described. The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.
The specific activity was determined by the dose dependent stimulation of proliferation of the Balb/c 3T3 cell line, the ED50 is 0.03ng/ml.
Lyophilized FGF-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution FGF-b should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.