WNV Pre-M
目录号 : GP25521West Nile Virus Pre-M Recombinant
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Protein is >95% pure as determined by SDS-PAGE. | Source | Escherichia Coli. |
| Phycical Appearance | Shipping Condition | Shipped with Ice Packs. | |
| Amino Acid Sequence | MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE. | ||
| Stability | WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C . Please prevent freeze thaw cycles. | ||
| Formulation | 20mM phosphate buffer pH 7.5. | ||
West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
Purified by proprietary chromatographic technique.
Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C . Please prevent freeze thaw cycles.