IL37 Human
目录号 : GP20670Interleukin-37 Human Recombinant
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. | Source | Escherichia Coli. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Interleukin-37; FIL1 zeta; IL-1X; Interleukin-1 family member 7; IL-1F7; Interleukin-1 homolog 4; IL-1H; IL-1H4; Interleukin-1 zeta; IL-1 zeta; Interleukin-1-related protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1; FIL1; FIL1(ZETA). | ||
| Amino Acid Sequence | MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYR | ||
| Solubility | It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C .Please prevent freeze-thaw cycles. | ||
| Biological Activity | As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 ?l/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml. | ||
| Formulation | IL37 was lyophilized from a 0.2μM filtered solution of 20mM PB, 150mM NaCl and 2mM DTT pH 7.4. | ||
Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 cytokine family. There are 5 alternatively spliced transcript variants encoding distinct isoforms with distinct expression profiles. The longest IL-1F7 transcript, named IL1F7b or IL1F7 isoform 1, encodes a 218 aa residues proprotein and containing a 45 aa propeptide which is cleaved to produce a mature protein. IL1F7b binds to IL18 Rb with low affinity however it doesnбпt exert any IL18 agonistic or antagonistic effects. IL1F7b also binds IL18BP (interleukin 18 binding protein), which is an inhibitory binding protein of interleukin 18 (IL18), and afterward forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18.
As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 ?l/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml.
Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C .Please prevent freeze-thaw cycles.