IL 1 alpha Human
目录号 : GP20439Interleukin-1 alpha Human Recombinant
Sample solution is provided at 25 µL, 10mM.
| Purity | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. | Source | Escherichia Coli. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Hematopoietin-1; Lymphocyte-activating factor (LAF); Endogenous Pyrogen (EP); Leukocyte Endogenous Mediator (LEM); Mononuclear Cell Factor (MCF); IL-1 alpha;IL1; IL-1A; IL1F1. | ||
| Amino Acid Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA. | ||
| Solubility | It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C .Please prevent freeze-thaw cycles. | ||
| Biological Activity | The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg. | ||
| Formulation | The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25mM Tris-HCl, pH 8. | ||
IL-1 alpha is produced by activated macrophages, stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1A proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg.
Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C .Please prevent freeze-thaw cycles.















