HPV 11
目录号 : GP25440Human Papillomavirus 11 Recombinant
Sample solution is provided at 25 µL, 10mM.
| Purity | Protein is >80% pure as determined by 10% PAGE (coomassie staining). | Source | E.Coli. |
| Phycical Appearance | Sterile filtered clear liquid formulation. | Shipping Condition | Shipped with Ice Packs. |
| Synonyms | Papillomavirus; HPV; Papilloma Virus. | ||
| Amino Acid Sequence | VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR. | ||
| Stability | Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C . Please prevent freeze thaw cycles. | ||
| Formulation | Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine. | ||
Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV 11 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV 11 large capsid is used as a potential candiadate for vaccine development.
Each laboratory should determine an optimum working titer for use in its particular application.
Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C . Please prevent freeze thaw cycles.















