Der P1
目录号 : GP25128Der P1 重组蛋白
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
The E.Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.5kDa, pI 5.6.
| Purity | Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining). | Source | Escherichia Coli. |
| Phycical Appearance | Shipping Condition | Shipped with Ice Packs. | |
| Synonyms | Peptidase 1; Major mite fecal allergen Der p 1; Allergen Der p I; Der p 1; DERP1; Der-P1. | ||
| Amino Acid Sequence | MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH. | ||
| Stability | Der-P1 although stable at 4°C for 1 week, should be stored below -18°C .Please prevent freeze thaw cycles. | ||
| Formulation | (1mg/ml) 60mM NaCl, 50mM Tris-HCl pH 8.0 and 1.2M Urea. | ||
DERP1 is a thiol protease, with a preference for substrates with a large hydrophobic side chain in the P2 position, or with basic residues. DERP1 is a C1 peptidase family member. DERP1 has extensive endopeptidase specificity. DERP1 is N-glycosylated. N-glycanase treatment does not completely remove carbohydrates, suggesting that the protein contains additional glycosylation sites. DERP1 causes an allergic reaction in humans. Common symptoms of mite allergy are bronchial asthma, allergic rhinitis and conjunctivitis. DERP1 binds to IgE in 80% of patients with house dust allergy.
Purified by proprietary chromatographic technique.
Der-P1 although stable at 4°C for 1 week, should be stored below -18°C .Please prevent freeze thaw cycles.