BMP 7 Human, Plant
目录号 : GP20111Bone Morphogenetic Protein-7 Human Recombinant, Plant
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 97.0% as determined by SDS-PAGE. | Source | Nicotiana benthamiana. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Osteogenic Protein 1; BMP-7. | ||
| Amino Acid Sequence | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH. | ||
| Solubility | Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/?l. | ||
| Stability | Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. | ||
| Biological Activity | The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50is less than40ng/ml, corresponding to a specific activity of 25,000 units/mg. | ||
| Formulation | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. | ||
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50is less than40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.