SELE Human, HEK
目录号 : GP24518E-Selectin Human Recombinant, HEK
Sample solution is provided at 25 µL, 10mM.
Purity | Greater than 95% as determined by SDS-PAGE. | Source | HEK293 cells. |
Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
Synonyms | E-selectin; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD62E antigen; SELE; ELAM1; ELAM; ESEL; CD62E. | ||
Amino Acid Sequence | WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH. | ||
Solubility | It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | ||
Stability | Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles. | ||
Formulation | SELE was lyophilized from a 0.2 µM filtered solution of PBS and 4% Mannitol, pH 7.5. |
E-selectin which is also called Endothelial leukocyte adhesion molecule 1, ELAM1, ELAM belongs to a family of divalent cation-dependent carbohydrate-binding glycoproteins or adhesion molecules. Eselectin is expressed on the surface of endothelial cells and mediates the interaction of leukocytes and platelets with endothelial cells during an inflammatory response. E-selectin is present in single copy in the human genome and contains 14 exons spanning about 13 kb of DNA.
Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles.