HIV-1 Integrase
目录号 : GP25409HIV-1 Integrase Recombinant
    
    
Sample solution is provided at 25 µL, 10mM.
| Purity | Greater than 95.0% as determined by SDS-PAGE. | Source | Escherichia Coli. | 
| Phycical Appearance | Sterile filtered colorless clear solution. | Shipping Condition | Shipped with Ice Packs. | 
| Amino Acid Sequence | MFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEDHHHHHH. | ||
| Stability | HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C . Please prevent freeze thaw cycles. | ||
| Formulation | 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol. | ||
Integrase is an enzyme produced by the HIV which enables its genetic material to be integrated into the DNA of the infected cell and is a key component in the pre-integration complex. HIV integrase contains 3 domains, an N-terminal HH-CC zinc fingerdomainwhich is partially responsible for multimerization, a central catalytic domain and a C-terminal domain. Both Central catalytic domain and C-terminal domains have been shown to bind both viral and cellular DNA. No crystal structure data exists with Integrase bound to its DNA substrates. HIV-1 integrase functions as a dimeror a tetramer. Additionally, several host cellular proteins interact with integrase and may facilitate the integration process.
HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C . Please prevent freeze thaw cycles.
  
  
  
  














